PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_19052.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MYB
Protein Properties Length: 286aa    MW: 30611 Da    PI: 5.2301
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_19052.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.7e-162269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+  ++++G  tW+++a+  g++R++k+c++rw +yl
     MLOC_19052.1 22 KGLWSPEEDERLYTRITRHGVSTWSSVAQLAGLRRSGKSCRLRWMNYL 69
                     678*******************************************97 PP

2Myb_DNA-binding42.12e-1377117345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + ++ E+e ++ + k lG++ W+ Ia +m+ gRt++++k++w+
     MLOC_19052.1  77 PISKREEETIISLQKSLGNR-WSVIAGKMP-GRTDNEIKNYWN 117
                      56889***************.*********.***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.9141773IPR017930Myb domain
SuperFamilySSF466891.15E-2721116IPR009057Homeodomain-like
SMARTSM007172.9E-122171IPR001005SANT/Myb domain
PfamPF002492.7E-142269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-212376IPR009057Homeodomain-like
CDDcd001671.12E-102569No hitNo description
PROSITE profilePS5129416.07674124IPR017930Myb domain
SMARTSM007172.2E-1274122IPR001005SANT/Myb domain
CDDcd001677.57E-1077117No hitNo description
Gene3DG3DSA:1.10.10.603.6E-2277123IPR009057Homeodomain-like
PfamPF002494.9E-1177118IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MVEKPASQAN AGGDVEARKE RKGLWSPEED ERLYTRITRH GVSTWSSVAQ LAGLRRSGKS  60
CRLRWMNYLR PDLKKEPISK REEETIISLQ KSLGNRWSVI AGKMPGRTDN EIKNYWNSRI  120
RKRQNISAGG GKGDGELAKQ GDLPAADDKA NVLAVAGGME PVSSMATGAT APPVPTRFPL  180
FACQLFGGGG EATAVAAAGT TAESTTTHEN NGAGSESDVS VGNGGQDGRE GHYYYCAVEG  240
DIDMVHLMSF DDLLEYPAGG DLLMDAWDQN GLYSANTGSS VDSFGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-242212327127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-150HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232989.11e-102PREDICTED: myb-related protein Myb4
TrEMBLM0V6410.0M0V641_HORVD; Uncharacterized protein
STRINGMLOC_19052.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-46myb domain protein 86